SCOPe 2.06: Domain d4icgd_: 4icg D:

Lineage for d4icgd_ (4icg D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.5: Hemolysin expression modulating protein HHA [68989] (2 families)
   automatically mapped to Pfam PF05321

5. Family a.23.5.1: Hemolysin expression modulating protein HHA [68990] (2 proteins)

6. Protein automated matches [196791] (2 species)
   not a true protein

7. Species Salmonella enterica [TaxId:990282] [196792] (1 PDB entry)

8. Domain d4icgd_: 4icg D: [196793]
   automated match to d1jw2a_
   protein/DNA complex

Details for d4icgd_

PDB Entry: 4icg, 2.92 Å

PDB Description: n-terminal dimerization domain of h-ns in complex with hha (salmonella typhimurium)

PDB Compounds: (D:) Hemolysin expression-modulating protein

SCOPe Domain Sequences for d4icgd_:

Sequence; same for both SEQRES and ATOM records:

>d4icgd_ a.23.5.1 (D:) automated matches {Salmonella enterica [TaxId: 990282]}
pltktdylmrlrrcqtidtlervieknkyelsdnelavfysaadhrlaeltmnklydkip
ssvwkfir

Timeline for d4icgd_:

• d4icgd_ first appeared in SCOPe 2.02
  
• d4icgd_ appears in SCOPe 2.05
  
• d4icgd_ appears in SCOPe 2.07
  
• d4icgd_ appears in the current release, SCOPe 2.08