SCOPe 2.08: Domain d1fgja_: 1fgj A:

Lineage for d1fgja_ (1fgj A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Hydroxylamine oxidoreductase, HAO [48712] (1 species)
   contains 3 complete motifs

7. Species Nitrosomonas europaea [TaxId:915] [48713] (1 PDB entry)

8. Domain d1fgja_: 1fgj A: [19679]
   complexed with hec, hem

Details for d1fgja_

PDB Entry: 1fgj, 2.8 Å

PDB Description: x-ray structure of hydroxylamine oxidoreductase

PDB Compounds: (A:) hydroxylamine oxidoreductase

SCOPe Domain Sequences for d1fgja_:

Sequence; same for both SEQRES and ATOM records:

>d1fgja_ a.138.1.3 (A:) Hydroxylamine oxidoreductase, HAO {Nitrosomonas europaea [TaxId: 915]}
distvpdetydalkldrgkatpketyealvkrykdpahgagkgtmgdywepiaisiymdp
ntfykppvspkevaerkdcvechsdetpvwvrawkrsthanldkirnlksddplyykkgk
leevennlrsmgklgeketlkevgcidchvdvnkkdkadhtkdirmptadtcgtchlref
aereserdtmvwpngqwpagrpshaldytaniettvwatmpqrevaegctmchtnqnkcd
nchtrhefsaaesrkpeacatchsgvdhnnweaytmskhgklaemnrdkwnwevrlkdaf
skggqnaptcaachmeyegeythnitrktrwanypfvpgiaenitsdwsearldswvltc
tqchserfarsyldlmdkgtleglakyqeanaivhkmyedgtltgqktnrpnppepekpg
fgiftqlfwskgnnpaslelkvlemgennlakmhvglahvnpggwtytegwgpmnrayve
iqdeytkmqelsalqarvn

Timeline for d1fgja_:

• d1fgja_ first appeared (with stable ids) in SCOP 1.55
  
• d1fgja_ appears in SCOPe 2.07