Lineage for d4hwwa_ (4hww A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1167070Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 1167071Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 1167072Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 1167093Protein Arginase [52770] (5 species)
  7. 1167125Species Human (Homo sapiens) [TaxId:9606] [142346] (24 PDB entries)
    Uniprot P05089 5-313
  8. 1167126Domain d4hwwa_: 4hww A: [196786]
    automated match to d3gmza_
    complexed with mn, x7a

Details for d4hwwa_

PDB Entry: 4hww (more details), 1.3 Å

PDB Description: crystal structure of human arginase-1 complexed with inhibitor 9
PDB Compounds: (A:) Arginase-1

SCOPe Domain Sequences for d4hwwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hwwa_ c.42.1.1 (A:) Arginase {Human (Homo sapiens) [TaxId: 9606]}
srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
gtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
glaregnhkpidyl

SCOPe Domain Coordinates for d4hwwa_:

Click to download the PDB-style file with coordinates for d4hwwa_.
(The format of our PDB-style files is described here.)

Timeline for d4hwwa_: