Lineage for d4hrtb_ (4hrt B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1255628Protein automated matches [190359] (36 species)
    not a true protein
  7. 1255636Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (31 PDB entries)
  8. 1255637Domain d4hrtb_: 4hrt B: [196783]
    Other proteins in same PDB: d4hrta_, d4hrtc_, d4hrte_, d4hrtg_
    automated match to d1sctb_
    complexed with hem, po4

Details for d4hrtb_

PDB Entry: 4hrt (more details), 1.46 Å

PDB Description: Scapharca tetrameric hemoglobin, unliganded
PDB Compounds: (B:) Hemoglobin B chain

SCOPe Domain Sequences for d4hrtb_:

Sequence, based on SEQRES records: (download)

>d4hrtb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
rvaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvsa
gkdnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgplr
qtlkarmgnyfdedtvaawaslvavvqaal

Sequence, based on observed residues (ATOM records): (download)

>d4hrtb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
rvaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvsd
nsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgplrqtl
karmgnyfdedtvaawaslvavvqaal

SCOPe Domain Coordinates for d4hrtb_:

Click to download the PDB-style file with coordinates for d4hrtb_.
(The format of our PDB-style files is described here.)

Timeline for d4hrtb_: