Lineage for d4h2lb_ (4h2l B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1475069Protein automated matches [190359] (38 species)
    not a true protein
  7. 1475310Species Peromyscus maniculatus [TaxId:10042] [196779] (1 PDB entry)
  8. 1475311Domain d4h2lb_: 4h2l B: [196782]
    Other proteins in same PDB: d4h2la_
    automated match to d3hrwb_
    complexed with hem

Details for d4h2lb_

PDB Entry: 4h2l (more details), 1.78 Å

PDB Description: Deer mouse hemoglobin in hydrated format
PDB Compounds: (B:) Beta globin

SCOPe Domain Sequences for d4h2lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h2lb_ a.1.1.2 (B:) automated matches {Peromyscus maniculatus [TaxId: 10042]}
vhltdaekalvtglwgkvkpeeiggealgrllavypwtqrffdsfgdlssasaimgnakv
kahgkkvidsfseglkhldnlkgtfaslselhcdklhvdpenfkllgnmivivmahhlgk
dftpaaqsayqkvvsgvatalahkyh

SCOPe Domain Coordinates for d4h2lb_:

Click to download the PDB-style file with coordinates for d4h2lb_.
(The format of our PDB-style files is described here.)

Timeline for d4h2lb_: