SCOPe 2.08: Domain d4h2lb_: 4h2l B:

Lineage for d4h2lb_ (4h2l B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Peromyscus maniculatus [TaxId:10042] [196779] (2 PDB entries)

8. Domain d4h2lb_: 4h2l B: [196782]
   Other proteins in same PDB: d4h2la_
   automated match to d3hrwb_
   complexed with hem

Details for d4h2lb_

PDB Entry: 4h2l, 1.78 Å

PDB Description: Deer mouse hemoglobin in hydrated format

PDB Compounds: (B:) Beta globin

SCOPe Domain Sequences for d4h2lb_:

Sequence; same for both SEQRES and ATOM records:

>d4h2lb_ a.1.1.2 (B:) automated matches {Peromyscus maniculatus [TaxId: 10042]}
vhltdaekalvtglwgkvkpeeiggealgrllavypwtqrffdsfgdlssasaimgnakv
kahgkkvidsfseglkhldnlkgtfaslselhcdklhvdpenfkllgnmivivmahhlgk
dftpaaqsayqkvvsgvatalahkyh

Timeline for d4h2lb_:

• d4h2lb_ first appeared in SCOPe 2.02
  
• d4h2lb_ appears in SCOPe 2.07