SCOPe 2.03: Domain d4h2la_: 4h2l A:

Lineage for d4h2la_ (4h2l A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (23 species)

7. Species Peromyscus maniculatus [TaxId:10042] [224840] (1 PDB entry)

8. Domain d4h2la_: 4h2l A: [196780]
   Other proteins in same PDB: d4h2lb_
   automated match to d3hrwa_
   complexed with hem

Details for d4h2la_

PDB Entry: 4h2l, 1.78 Å

PDB Description: Deer mouse hemoglobin in hydrated format

PDB Compounds: (A:) Alpha-globin

SCOPe Domain Sequences for d4h2la_:

Sequence; same for both SEQRES and ATOM records:

>d4h2la_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Peromyscus maniculatus [TaxId: 10042]}
vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvshgsaqvkahgg
kvadalataaghlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahlpsdftpa
vhasldkflasvstvltskyr

Timeline for d4h2la_:

• d4h2la_ first appeared in SCOPe 2.02
  
• d4h2la_ appears in SCOPe 2.04
  
• d4h2la_ appears in the current release, SCOPe 2.08