Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (36 species) not a true protein |
Species Peromyscus maniculatus [TaxId:10042] [196779] (1 PDB entry) |
Domain d4h2la_: 4h2l A: [196780] automated match to d3hrwa_ complexed with hem |
PDB Entry: 4h2l (more details), 1.78 Å
SCOPe Domain Sequences for d4h2la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h2la_ a.1.1.2 (A:) automated matches {Peromyscus maniculatus [TaxId: 10042]} vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvshgsaqvkahgg kvadalataaghlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahlpsdftpa vhasldkflasvstvltskyr
Timeline for d4h2la_: