Lineage for d4h2la_ (4h2l A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686983Species Peromyscus maniculatus [TaxId:10042] [224840] (1 PDB entry)
  8. 2686984Domain d4h2la_: 4h2l A: [196780]
    Other proteins in same PDB: d4h2lb_
    automated match to d3hrwa_
    complexed with hem

Details for d4h2la_

PDB Entry: 4h2l (more details), 1.78 Å

PDB Description: Deer mouse hemoglobin in hydrated format
PDB Compounds: (A:) Alpha-globin

SCOPe Domain Sequences for d4h2la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h2la_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Peromyscus maniculatus [TaxId: 10042]}
vlsaddkanikaawgkigghgaeygaealermfcsfpttktyfphfdvshgsaqvkahgg
kvadalataaghlddlpaalsalsdlhahklrvdpvnfkllshcllvtlaahlpsdftpa
vhasldkflasvstvltskyr

SCOPe Domain Coordinates for d4h2la_:

Click to download the PDB-style file with coordinates for d4h2la_.
(The format of our PDB-style files is described here.)

Timeline for d4h2la_: