Domain d1eysc_: 1eys C:

Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)

Lineage for d1eysc_ (1eys C:)

Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds)
Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
variable number of helices and little beta structure; not a true fold
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
duplication: contains multiple CxxCH motifs
Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
consists of four heme-binding repeats
Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
Species Thermochromatium tepidum [TaxId:1050] [48710] (1 PDB entry)
Domain d1eysc_: 1eys C: [19678]
Other proteins in same PDB: d1eysh1, d1eysh2, d1eysl_, d1eysm_
complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef

Details for d1eysc_

PDB Entry: 1eys (more details)
PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum
PDB Compounds: (C:) photosynthetic reaction center

SCOP Domain Sequences for d1eysc_:
Sequence; same for both SEQRES and ATOM records: (download)

>d1eysc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Thermochromatium tepidum [TaxId: 1050]} cegpppgteqigyrgvgmenyyvkrqralsiqanqpveslpaadstgpkasevyqsvqvl kdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvraansdwk ahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslpfdpltp fldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctschntrafndwtqs tpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnkplygaq makdypglyk

SCOP Domain Coordinates for d1eysc_:

Click to download the PDB-style file with coordinates for d1eysc_.
(The format of our PDB-style files is described here.)

Timeline for d1eysc_:
d1eysc_ appears in SCOP 1.73
d1eysc_ appears in SCOP 1.75A

d1eysc_
(click for larger image)

d1eysc_ in context of PDB
Domains from other chains:
d1eysh1, d1eysh2, d1eysl_, d1eysm_