Lineage for d1eysc_ (1eys C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218289Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 218290Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 218344Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
    consists of four heme-binding repeats
  6. 218345Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 218355Species Thermochromatium tepidum [TaxId:1050] [48710] (1 PDB entry)
  8. 218356Domain d1eysc_: 1eys C: [19678]
    Other proteins in same PDB: d1eysh1, d1eysh2, d1eysl_, d1eysm_
    complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef

Details for d1eysc_

PDB Entry: 1eys (more details), 2.2 Å

PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum

SCOP Domain Sequences for d1eysc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eysc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Thermochromatium tepidum}
cegpppgteqigyrgvgmenyyvkrqralsiqanqpveslpaadstgpkasevyqsvqvl
kdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvraansdwk
ahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslpfdpltp
fldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctschntrafndwtqs
tpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnkplygaq
makdypglyk

SCOP Domain Coordinates for d1eysc_:

Click to download the PDB-style file with coordinates for d1eysc_.
(The format of our PDB-style files is described here.)

Timeline for d1eysc_: