SCOPe 2.05: Domain d4ghpa_: 4ghp A:

Lineage for d4ghpa_ (4ghp A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
   multihelical; 2 layers or orthogonally packed helices

4. Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family)

5. Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)

6. Protein Glycolipid transfer protein, GLTP [110006] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
   Uniprot Q9NZD2

8. Domain d4ghpa_: 4ghp A: [196775]
   automated match to d2evta_
   complexed with eis; mutant

Details for d4ghpa_

PDB Entry: 4ghp, 1.9 Å

PDB Description: Crystal Structure of D48V||A47D mutant of Human GLTP bound with 12:0 monosulfatide

PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d4ghpa_:

Sequence; same for both SEQRES and ATOM records:

>d4ghpa_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
llkplpadkqietgpfleavshlppffdclgspvftpikdvisgnitkikavydtnpakf
rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
atkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvny
tatidviyemytqmnaelnykv

Timeline for d4ghpa_:

• d4ghpa_ first appeared in SCOPe 2.02
  
• d4ghpa_ appears in SCOPe 2.04
  
• d4ghpa_ appears in SCOPe 2.06
  
• d4ghpa_ appears in the current release, SCOPe 2.08