Lineage for d4ghpa_ (4ghp A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737813Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 2737814Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 2737815Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)
  6. 2737816Protein Glycolipid transfer protein, GLTP [110006] (2 species)
  7. 2737819Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
    Uniprot Q9NZD2
  8. 2737829Domain d4ghpa_: 4ghp A: [196775]
    automated match to d2evta_
    complexed with eis; mutant

Details for d4ghpa_

PDB Entry: 4ghp (more details), 1.9 Å

PDB Description: Crystal Structure of D48V||A47D mutant of Human GLTP bound with 12:0 monosulfatide
PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d4ghpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ghpa_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
llkplpadkqietgpfleavshlppffdclgspvftpikdvisgnitkikavydtnpakf
rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
atkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvny
tatidviyemytqmnaelnykv

SCOPe Domain Coordinates for d4ghpa_:

Click to download the PDB-style file with coordinates for d4ghpa_.
(The format of our PDB-style files is described here.)

Timeline for d4ghpa_: