SCOPe 2.06: Domain d4gh7c_: 4gh7 C:

Lineage for d4gh7c_ (4gh7 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (39 PDB entries)

8. Domain d4gh7c_: 4gh7 C: [196774]
   automated match to d3dtqc_

Details for d4gh7c_

PDB Entry: 4gh7, 2.6 Å

PDB Description: crystal structure of anticalin n7a in complex with oncofetal fibronectin fragment fn7b8

PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d4gh7c_:

Sequence; same for both SEQRES and ATOM records:

>d4gh7c_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfhgkwyvvgkagnhdlredkdprkmqatiyelkedksy
nvtnvrfvhkkcnyriwtfvpgsqpgeftlgnikswpgltswlvrvvstnynqhamvffk
rvyqnrelfeitlygrtkeltnelkenfirfskslglpenhivfpvpidqcidg

Timeline for d4gh7c_:

• d4gh7c_ first appeared in SCOPe 2.02
  
• d4gh7c_ appears in SCOPe 2.05
  
• d4gh7c_ appears in SCOPe 2.07
  
• d4gh7c_ appears in the current release, SCOPe 2.08