SCOPe 2.02: Domain d4f95a_: 4f95 A:

Lineage for d4f95a_ (4f95 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.0: automated matches [191335] (1 protein)
   not a true family

6. Protein automated matches [190179] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187020] (4 PDB entries)

8. Domain d4f95a_: 4f95 A: [196770]
   automated match to d2i5da_

Details for d4f95a_

PDB Entry: 4f95, 2.07 Å

PDB Description: Crystal structure of human inosine triphosphate pyrophosphatase P32T variant

PDB Compounds: (A:) inosine triphosphate pyrophosphatase

SCOPe Domain Sequences for d4f95a_:

Sequence; same for both SEQRES and ATOM records:

>d4f95a_ c.51.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslvgkkivfvtgnakkleevvqilgdkftctlvaqkidlpeyqgepdeisiqkcqeavr
qvqgpvlvedtclcfnalgglpgpyikwfleklkpeglhqllagfedksayalctfalst
gdpsqpvrlfrgrtsgrivaprgcqdfgwdpcfqpdgyeqtyaempkaeknavshrfral
lelqeyfgs

Timeline for d4f95a_:

• d4f95a_ is new in SCOPe 2.02-stable
  
• d4f95a_ appears in SCOPe 2.03
  
• d4f95a_ appears in the current release, SCOPe 2.08