Lineage for d7prcc_ (7prc C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347197Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2347198Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2347306Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
    consists of four heme-binding repeats
    automatically mapped to Pfam PF02276
  6. 2347307Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 2347308Species Rhodopseudomonas viridis [TaxId:1079] [48709] (28 PDB entries)
  8. 2347321Domain d7prcc_: 7prc C: [19677]
    Other proteins in same PDB: d7prch1, d7prch2, d7prch3, d7prcl_, d7prcm_
    complexed with bcb, bpb, cet, fe2, hem, lda, mq7, ns5, so4

Details for d7prcc_

PDB Entry: 7prc (more details), 2.65 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420315 (triazine) complex)
PDB Compounds: (C:) photosynthetic reaction center

SCOPe Domain Sequences for d7prcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOPe Domain Coordinates for d7prcc_:

Click to download the PDB-style file with coordinates for d7prcc_.
(The format of our PDB-style files is described here.)

Timeline for d7prcc_: