SCOPe 2.06: Domain d4eiha_: 4eih A:

Lineage for d4eiha_ (4eih A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein automated matches [190202] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries)

8. Domain d4eiha_: 4eih A: [196767]
   automated match to d3uyoa_
   complexed with cl

Details for d4eiha_

PDB Entry: 4eih, 1.2 Å

PDB Description: Crystal structure of Arg SH2 domain

PDB Compounds: (A:) Abelson tyrosine-protein kinase 2

SCOPe Domain Sequences for d4eiha_:

Sequence; same for both SEQRES and ATOM records:

>d4eiha_ d.93.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slekhswyhgpvsrsaaeyllsslingsflvresesspgqlsislryegrvyhyrintta
dgkvyvtaesrfstlaelvhhhstvadglvttlhypapkcn

Timeline for d4eiha_:

• d4eiha_ first appeared in SCOPe 2.02
  
• d4eiha_ appears in SCOPe 2.05
  
• d4eiha_ appears in SCOPe 2.07
  
• d4eiha_ appears in the current release, SCOPe 2.08