![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
![]() | Protein automated matches [190453] (26 species) not a true protein |
![]() | Species Synechococcus sp. [TaxId:32049] [196764] (2 PDB entries) |
![]() | Domain d4eiea_: 4eie A: [196766] automated match to d3ph2b_ complexed with cl, hec, na |
PDB Entry: 4eie (more details), 1.03 Å
SCOPe Domain Sequences for d4eiea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eiea_ a.3.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 32049]} dqgaqifeahcagchlnggnivrrgknlkkramakngytsveaianlvtqgkgnmsaygd klsseeiqavsqyvlqqsqtdw
Timeline for d4eiea_: