Lineage for d4eiea_ (4eie A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691752Species Synechococcus sp. [TaxId:32049] [196764] (2 PDB entries)
  8. 2691753Domain d4eiea_: 4eie A: [196766]
    automated match to d3ph2b_
    complexed with cl, hec, na

Details for d4eiea_

PDB Entry: 4eie (more details), 1.03 Å

PDB Description: crystal structure of cytochrome c6c from synechococcus sp. pcc 7002
PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d4eiea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eiea_ a.3.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 32049]}
dqgaqifeahcagchlnggnivrrgknlkkramakngytsveaianlvtqgkgnmsaygd
klsseeiqavsqyvlqqsqtdw

SCOPe Domain Coordinates for d4eiea_:

Click to download the PDB-style file with coordinates for d4eiea_.
(The format of our PDB-style files is described here.)

Timeline for d4eiea_: