Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (25 species) not a true protein |
Species Synechococcus sp. [TaxId:32049] [196764] (2 PDB entries) |
Domain d4eifa_: 4eif A: [196765] automated match to d2v08a_ complexed with cl, hem, na; mutant |
PDB Entry: 4eif (more details), 1.04 Å
SCOPe Domain Sequences for d4eifa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eifa_ a.3.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 32049]} dqgaqifeahcagchlnggnivrrgknlkkramakngytsveaianqvtqgkgnmsaygd klsseeiqavsqyvlqqsqtdw
Timeline for d4eifa_: