Lineage for d4eifa_ (4eif A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2305066Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2305067Protein automated matches [190453] (25 species)
    not a true protein
  7. 2305197Species Synechococcus sp. [TaxId:32049] [196764] (2 PDB entries)
  8. 2305198Domain d4eifa_: 4eif A: [196765]
    automated match to d2v08a_
    complexed with cl, hem, na; mutant

Details for d4eifa_

PDB Entry: 4eif (more details), 1.04 Å

PDB Description: crystal structure of cytochrome c6c l50q mutant from synechococcus sp. pcc 7002
PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d4eifa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eifa_ a.3.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 32049]}
dqgaqifeahcagchlnggnivrrgknlkkramakngytsveaianqvtqgkgnmsaygd
klsseeiqavsqyvlqqsqtdw

SCOPe Domain Coordinates for d4eifa_:

Click to download the PDB-style file with coordinates for d4eifa_.
(The format of our PDB-style files is described here.)

Timeline for d4eifa_: