| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
| Protein automated matches [190453] (26 species) not a true protein |
| Species Synechococcus sp. [TaxId:32049] [196764] (2 PDB entries) |
| Domain d4eifa_: 4eif A: [196765] automated match to d2v08a_ complexed with cl, hec, na; mutant |
PDB Entry: 4eif (more details), 1.04 Å
SCOPe Domain Sequences for d4eifa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eifa_ a.3.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 32049]}
dqgaqifeahcagchlnggnivrrgknlkkramakngytsveaianqvtqgkgnmsaygd
klsseeiqavsqyvlqqsqtdw
Timeline for d4eifa_: