Lineage for d4prcc_ (4prc C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51478Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 51479Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 51517Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
  6. 51518Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 51519Species Rhodopseudomonas viridis [TaxId:1079] [48709] (8 PDB entries)
  8. 51526Domain d4prcc_: 4prc C: [19676]
    Other proteins in same PDB: d4prch1, d4prch2, d4prcl1, d4prcm1

Details for d4prcc_

PDB Entry: 4prc (more details), 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (stigmatellin complex)

SCOP Domain Sequences for d4prcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOP Domain Coordinates for d4prcc_:

Click to download the PDB-style file with coordinates for d4prcc_.
(The format of our PDB-style files is described here.)

Timeline for d4prcc_: