Lineage for d3w24a_ (3w24 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (93 species)
    not a true protein
  7. 2419500Species Thermoanaerobacterium saccharolyticum [TaxId:1094508] [196751] (6 PDB entries)
  8. 2419502Domain d3w24a_: 3w24 A: [196752]
    automated match to d2depa_

Details for d3w24a_

PDB Entry: 3w24 (more details), 1.35 Å

PDB Description: The high-resolution crystal structure of TsXylA, intracellular xylanase from Thermoanaerobacterium saccharolyticum JW/SL-YS485
PDB Compounds: (A:) Glycoside hydrolase family 10

SCOPe Domain Sequences for d3w24a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w24a_ c.1.8.0 (A:) automated matches {Thermoanaerobacterium saccharolyticum [TaxId: 1094508]}
tiqndipdlysvfkdyfpigvavdpsrlndadphaqltakhfnmlvaenamkpeslqpte
gnftfdnadkivdyaiahnmkmrghtllwhnqvpdwffqdpsdpskpasrdlllqrlrth
ittvldhfktkygsqnpiigwdvvnevlddngnlrnskwlqiigpdyiekafeyaheadp
smklfindynienngvktqamydlvkklknegvpingigmqmhisinsnidnikasiekl
aslgveiqvteldmnmngdvsndallkqarlykqlfdlfkaekqyitavvfwgvsddvsw
lskpnapllfdsklqakpaywaiv

SCOPe Domain Coordinates for d3w24a_:

Click to download the PDB-style file with coordinates for d3w24a_.
(The format of our PDB-style files is described here.)

Timeline for d3w24a_: