SCOPe 2.03: Domain d2prcc_: 2prc C:

Lineage for d2prcc_ (2prc C:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [48709] (16 PDB entries)

8. Domain d2prcc_: 2prc C: [19675]
   Other proteins in same PDB: d2prch1, d2prch2, d2prcl_, d2prcm_
   complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, so4, uq2

Details for d2prcc_

PDB Entry: 2prc, 2.45 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (ubiquinone-2 complex)

PDB Compounds: (C:) photosynthetic reaction center

SCOPe Domain Sequences for d2prcc_:

Sequence; same for both SEQRES and ATOM records:

>d2prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

Timeline for d2prcc_:

• d2prcc_ first appeared (with stable ids) in SCOP 1.55
  
• d2prcc_ appears in SCOPe 2.02
  
• d2prcc_ appears in SCOPe 2.04
  
• d2prcc_ appears in the current release, SCOPe 2.08