![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins) consists of four heme-binding repeats automatically mapped to Pfam PF02276 |
![]() | Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species) |
![]() | Species Rhodopseudomonas viridis [TaxId:1079] [48709] (16 PDB entries) |
![]() | Domain d2prcc_: 2prc C: [19675] Other proteins in same PDB: d2prch1, d2prch2, d2prcl_, d2prcm_ complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, so4, uq2 |
PDB Entry: 2prc (more details), 2.45 Å
SCOPe Domain Sequences for d2prcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]} cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea pqadcrtchqgvtkplfgasrlkdypelgpik
Timeline for d2prcc_:
![]() Domains from other chains: (mouse over for more information) d2prch1, d2prch2, d2prcl_, d2prcm_ |