![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
![]() | Protein automated matches [190135] (18 species) not a true protein |
![]() | Species Trichoderma harzianum [TaxId:5544] [196740] (1 PDB entry) |
![]() | Domain d4h7mb1: 4h7m B:7-225 [196741] Other proteins in same PDB: d4h7ma2, d4h7ma3, d4h7mb2 automated match to d1oa3a_ |
PDB Entry: 4h7m (more details), 2.07 Å
SCOPe Domain Sequences for d4h7mb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h7mb1 b.29.1.11 (B:7-225) automated matches {Trichoderma harzianum [TaxId: 5544]} qtsceqyavfsggngysvsnnlwgqsagsgfgcitvnslnsaaswhadwqwsggqnnvks ypnvqiaipqkrivnsigsmpttaswsytgsnlradvaydlftasnpnhvtysgdyelmi wlarygdigpigsaqgtvtingqswtlyygfngamqvysfvapstvtnwsgdvknffnyl rdnkgypassqyvlsyqfgtepftgsgtlnvnswtasin
Timeline for d4h7mb1: