SCOPe 2.02: Domain d4f46a_: 4f46 A:

Lineage for d4f46a_ (4f46 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
   contains extra N-terminal all-alpha subdomain

6. Protein ADP ribosyl cyclase [56631] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159490] (31 PDB entries)
   Uniprot P28907 45-291

8. Domain d4f46a_: 4f46 A: [196739]
   automated match to d3roka_
   complexed with dn4, dvn

Details for d4f46a_

PDB Entry: 4f46, 1.69 Å

PDB Description: Crystal structure of wild type human CD38 in complex with NAADP and ADPRP

PDB Compounds: (A:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d4f46a_:

Sequence; same for both SEQRES and ATOM records:

>d4f46a_ c.23.14.3 (A:) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
efwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcdite
edyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgef
dtskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfg
svevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdk
flqcvknp

Timeline for d4f46a_:

• d4f46a_ is new in SCOPe 2.02-stable
  
• d4f46a_ appears in SCOPe 2.03
  
• d4f46a_ appears in the current release, SCOPe 2.08, called d4f46a1