Lineage for d4f45a1 (4f45 A:46-296)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2103986Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2104030Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 protein domains)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 2104031Protein ADP ribosyl cyclase [56631] (4 species)
  7. 2104056Species Human (Homo sapiens) [TaxId:9606] [159490] (42 PDB entries)
    Uniprot P28907 45-291
  8. 2104097Domain d4f45a1: 4f45 A:46-296 [196738]
    Other proteins in same PDB: d4f45a2, d4f45b2
    automated match to d2o3ta_
    complexed with dn4; mutant

Details for d4f45a1

PDB Entry: 4f45 (more details), 2.1 Å

PDB Description: Crystal structure of human CD38 E226Q mutant in complex with NAADP
PDB Compounds: (A:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d4f45a1:

Sequence, based on SEQRES records: (download)

>d4f45a1 c.23.14.3 (A:46-296) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
wrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeed
yqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefdt
skinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsv
qvhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkfl
qcvknpedssc

Sequence, based on observed residues (ATOM records): (download)

>d4f45a1 c.23.14.3 (A:46-296) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
wrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeed
yqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefdt
skinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsv
qvhnlqpekvqtleawvihggrdlcqdptikelesiiskrniqfsckniyrpdkflqcvk
npedssc

SCOPe Domain Coordinates for d4f45a1:

Click to download the PDB-style file with coordinates for d4f45a1.
(The format of our PDB-style files is described here.)

Timeline for d4f45a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4f45a2