Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (5 PDB entries) |
Domain d3w31b_: 3w31 B: [196731] automated match to d2c2vb_ complexed with iod |
PDB Entry: 3w31 (more details), 2.96 Å
SCOPe Domain Sequences for d3w31b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w31b_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} maglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpe eypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddp landvaeqwktneaqaietarawtrlyamnni
Timeline for d3w31b_: