Lineage for d3w31b_ (3w31 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1406955Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1407022Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (4 PDB entries)
  8. 1407029Domain d3w31b_: 3w31 B: [196731]
    automated match to d2c2vb_
    complexed with iod

Details for d3w31b_

PDB Entry: 3w31 (more details), 2.96 Å

PDB Description: structual basis for the recognition of ubc13 by the shigella flexneri effector ospi
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d3w31b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w31b_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
maglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpe
eypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddp
landvaeqwktneaqaietarawtrlyamnni

SCOPe Domain Coordinates for d3w31b_:

Click to download the PDB-style file with coordinates for d3w31b_.
(The format of our PDB-style files is described here.)

Timeline for d3w31b_: