Lineage for d4h97b1 (4h97 B:4-192)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2153717Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2153920Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2154061Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)
  8. 2154089Domain d4h97b1: 4h97 B:4-192 [196722]
    Other proteins in same PDB: d4h97a2, d4h97b2
    automated match to d1aoea_
    complexed with 53s, gol, ndp

Details for d4h97b1

PDB Entry: 4h97 (more details), 2.2 Å

PDB Description: Candida albicans dihydrofolate reductase complexed with NADPH and 5-{3-[3-methoxy-5-(4-methylphenyl)phenyl]but-1-yn-1-yl}-6-methylpyrimidine-2,4-diamine (UCP111D4M)
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d4h97b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h97b1 c.71.1.1 (B:4-192) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
pnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwesip
qkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiynelin
nslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikegdft
ynytlwtrk

SCOPe Domain Coordinates for d4h97b1:

Click to download the PDB-style file with coordinates for d4h97b1.
(The format of our PDB-style files is described here.)

Timeline for d4h97b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h97b2