![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
![]() | Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species) |
![]() | Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries) |
![]() | Domain d4h97b_: 4h97 B: [196722] automated match to d1aoea_ complexed with 53s, gol, ndp |
PDB Entry: 4h97 (more details), 2.2 Å
SCOPe Domain Sequences for d4h97b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h97b_ c.71.1.1 (B:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]} kpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwesi pqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyneli nnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikegdf tynytlwtrk
Timeline for d4h97b_: