SCOPe 2.02: Domain d4h97b_: 4h97 B:

Lineage for d4h97b_ (4h97 B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (6 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [53609] (14 PDB entries)

8. Domain d4h97b_: 4h97 B: [196722]
   automated match to d1aoea_
   complexed with 53s, gol, nap

Details for d4h97b_

PDB Entry: 4h97, 2.2 Å

PDB Description: Candida albicans dihydrofolate reductase complexed with NADPH and 5-{3-[3-methoxy-5-(4-methylphenyl)phenyl]but-1-yn-1-yl}-6-methylpyrimidine-2,4-diamine (UCP111D4M)

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d4h97b_:

Sequence; same for both SEQRES and ATOM records:

>d4h97b_ c.71.1.1 (B:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
kpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwesi
pqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyneli
nnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikegdf
tynytlwtrk

Timeline for d4h97b_:

• d4h97b_ is new in SCOPe 2.02-stable
  
• d4h97b_ appears in SCOPe 2.03
  
• d4h97b_ appears in the current release, SCOPe 2.08, called d4h97b1