Lineage for d3prcc_ (3prc C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339824Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2339825Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2339933Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 protein domains)
    consists of four heme-binding repeats
    automatically mapped to Pfam PF02276
  6. 2339934Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 2339935Species Rhodopseudomonas viridis [TaxId:1079] [48709] (21 PDB entries)
  8. 2339943Domain d3prcc_: 3prc C: [19672]
    Other proteins in same PDB: d3prch1, d3prch2, d3prch3, d3prcl_, d3prcm_
    complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, so4

Details for d3prcc_

PDB Entry: 3prc (more details), 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (qb-depleted)
PDB Compounds: (C:) photosynthetic reaction center

SCOPe Domain Sequences for d3prcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOPe Domain Coordinates for d3prcc_:

Click to download the PDB-style file with coordinates for d3prcc_.
(The format of our PDB-style files is described here.)

Timeline for d3prcc_: