SCOPe 2.07: Domain d4h98b1: 4h98 B:4-217

Lineage for d4h98b1 (4h98 B:4-217)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Candida glabrata [TaxId:284593] [237803] (4 PDB entries)

8. Domain d4h98b1: 4h98 B:4-217 [196719]
   Other proteins in same PDB: d4h98a2, d4h98b2
   automated match to d3csea_
   complexed with 14q, ndp

Details for d4h98b1

PDB Entry: 4h98, 2.9 Å

PDB Description: Candida glabrata dihydrofolate reductase complexed with NADPH and 5-{3-[3-(2,3-dihydro-1,4-benzodioxin-6-yl)-5-methoxyphenyl]prop-1-yn-1-yl}-6-ethylpyrimidine-2,4-diamine (UCP1018)

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d4h98b1:

Sequence; same for both SEQRES and ATOM records:

>d4h98b1 c.71.1.1 (B:4-217) Dihydrofolate reductases, eukaryotic type {Candida glabrata [TaxId: 284593]}
vpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesip
qkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiigg
geiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiql
egrltsqewngelvkglpvqekgyqfyftlytkk

Timeline for d4h98b1:

• d4h98b1 first appeared in SCOPe 2.02, called d4h98b_
  
• d4h98b1 appears in SCOPe 2.06
  
• d4h98b1 appears in the current release, SCOPe 2.08