| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein) consists of four heme-binding repeats |
| Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species) |
| Species Rhodopseudomonas viridis [TaxId:1079] [48709] (8 PDB entries) |
| Domain d6prcc_: 6prc C: [19671] Other proteins in same PDB: d6prch1, d6prch2, d6prcl_, d6prcm_ complexed with 7mq, bcb, bpb, ceb, fe2, hem, lda, ns5, so4 |
PDB Entry: 6prc (more details), 2.3 Å
SCOP Domain Sequences for d6prcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik
Timeline for d6prcc_:
View in 3DDomains from other chains: (mouse over for more information) d6prch1, d6prch2, d6prcl_, d6prcm_ |