SCOP 1.63: Domain d6prcc_: 6prc C:

Lineage for d6prcc_ (6prc C:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
   consists of four heme-binding repeats

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [48709] (8 PDB entries)

8. Domain d6prcc_: 6prc C: [19671]
   Other proteins in same PDB: d6prch1, d6prch2, d6prcl_, d6prcm_
   complexed with 7mq, bcb, bpb, ceb, fe2, hem, lda, ns5, so4

Details for d6prcc_

PDB Entry: 6prc, 2.3 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420314 (triazine) complex)

SCOP Domain Sequences for d6prcc_:

Sequence; same for both SEQRES and ATOM records:

>d6prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

Timeline for d6prcc_:

• d6prcc_ first appeared (with stable ids) in SCOP 1.55
  
• d6prcc_ appears in SCOP 1.61
  
• d6prcc_ appears in SCOP 1.65
  
• d6prcc_ appears in the current release, SCOPe 2.08