Lineage for d6prcc_ (6prc C:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51478Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
  4. 51479Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
  5. 51517Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (1 protein)
  6. 51518Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)
  7. 51519Species Rhodopseudomonas viridis [TaxId:1079] [48709] (8 PDB entries)
  8. 51521Domain d6prcc_: 6prc C: [19671]
    Other proteins in same PDB: d6prch1, d6prch2, d6prcl1, d6prcm1

Details for d6prcc_

PDB Entry: 6prc (more details), 2.3 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420314 (triazine) complex)

SCOP Domain Sequences for d6prcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6prcc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

SCOP Domain Coordinates for d6prcc_:

Click to download the PDB-style file with coordinates for d6prcc_.
(The format of our PDB-style files is described here.)

Timeline for d6prcc_: