SCOPe 2.08: Domain d4enoa_: 4eno A:

Lineage for d4enoa_ (4eno A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (7 PDB entries)

8. Domain d4enoa_: 4eno A: [196709]
   automated match to d2hvda_
   complexed with po4

Details for d4enoa_

PDB Entry: 4eno, 2.8 Å

PDB Description: crystal structure of oxidized human nm23-h1

PDB Compounds: (A:) Nucleoside Diphosphate Kinase A

SCOPe Domain Sequences for d4enoa_:

Sequence; same for both SEQRES and ATOM records:

>d4enoa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
dsvesaekeiglwfhpeelvdytscaqnwiy

Timeline for d4enoa_:

• d4enoa_ first appeared in SCOPe 2.02
  
• d4enoa_ appears in SCOPe 2.07