| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
| Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
| Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (7 PDB entries) |
| Domain d4enob_: 4eno B: [196708] automated match to d2hvda_ complexed with po4 |
PDB Entry: 4eno (more details), 2.8 Å
SCOPe Domain Sequences for d4enob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4enob_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
dsvesaekeiglwfhpeelvdytscaqnw
Timeline for d4enob_: