Lineage for d4enob_ (4eno B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951165Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (7 PDB entries)
  8. 2951191Domain d4enob_: 4eno B: [196708]
    automated match to d2hvda_
    complexed with po4

Details for d4enob_

PDB Entry: 4eno (more details), 2.8 Å

PDB Description: crystal structure of oxidized human nm23-h1
PDB Compounds: (B:) Nucleoside Diphosphate Kinase A

SCOPe Domain Sequences for d4enob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4enob_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
dsvesaekeiglwfhpeelvdytscaqnw

SCOPe Domain Coordinates for d4enob_:

Click to download the PDB-style file with coordinates for d4enob_.
(The format of our PDB-style files is described here.)

Timeline for d4enob_: