SCOPe 2.04: Domain d4eb0a_: 4eb0 A:

Lineage for d4eb0a_ (4eb0 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (56 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [196706] (15 PDB entries)

8. Domain d4eb0a_: 4eb0 A: [196707]
   automated match to d1jfra_
   complexed with scn

Details for d4eb0a_

PDB Entry: 4eb0, 1.5 Å

PDB Description: crystal structure of leaf-branch compost bacterial cutinase homolog

PDB Compounds: (A:) lcc

SCOPe Domain Sequences for d4eb0a_:

Sequence; same for both SEQRES and ATOM records:

>d4eb0a_ c.69.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
snpyqrgpnptrsaltadgpfsvatytvsrlsvsgfgggviyyptgtsltfggiamspgy
tadasslawlgrrlashgfvvlvintnsrfdypdsrasqlsaalnylrtsspsavrarld
anrlavaghsmggggtlriaeqnpslkaavpltpwhtdktfntsvpvlivgaeadtvapv
sqhaipfyqnlpsttpkvyveldnashfapnsnnaaisvytiswmklwvdndtryrqflc
nvndpalsdfrtnnrhcq

Timeline for d4eb0a_:

• d4eb0a_ first appeared in SCOPe 2.02
  
• d4eb0a_ appears in SCOPe 2.03
  
• d4eb0a_ appears in SCOPe 2.05
  
• d4eb0a_ appears in the current release, SCOPe 2.08