Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Uncultured bacterium [TaxId:77133] [196706] (50 PDB entries) |
Domain d4eb0a_: 4eb0 A: [196707] automated match to d1jfra_ complexed with scn |
PDB Entry: 4eb0 (more details), 1.5 Å
SCOPe Domain Sequences for d4eb0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eb0a_ c.69.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]} snpyqrgpnptrsaltadgpfsvatytvsrlsvsgfgggviyyptgtsltfggiamspgy tadasslawlgrrlashgfvvlvintnsrfdypdsrasqlsaalnylrtsspsavrarld anrlavaghsmggggtlriaeqnpslkaavpltpwhtdktfntsvpvlivgaeadtvapv sqhaipfyqnlpsttpkvyveldnashfapnsnnaaisvytiswmklwvdndtryrqflc nvndpalsdfrtnnrhcq
Timeline for d4eb0a_: