Lineage for d4f4ga_ (4f4g A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143227Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 2143228Family c.92.1.1: Ferrochelatase [53801] (2 protein domains)
    automatically mapped to Pfam PF00762
  6. 2143229Protein Ferrochelatase [53802] (3 species)
  7. 2143251Species Human (Homo sapiens) [TaxId:9606] [64189] (21 PDB entries)
  8. 2143290Domain d4f4ga_: 4f4g A: [196705]
    automated match to d2hrca_
    complexed with chd, cl, fes, gol

Details for d4f4ga_

PDB Entry: 4f4g (more details), 2.5 Å

PDB Description: S197C variant of human ferrochelatase
PDB Compounds: (A:) Ferrochelatase, mitochondrial

SCOPe Domain Sequences for d4f4ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f4ga_ c.92.1.1 (A:) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]}
rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrrtpkiqeqyr
rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
aiaftqypqysccttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql

SCOPe Domain Coordinates for d4f4ga_:

Click to download the PDB-style file with coordinates for d4f4ga_.
(The format of our PDB-style files is described here.)

Timeline for d4f4ga_: