Lineage for d3zfca1 (3zfc A:5-344)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114479Species Mouse (Mus musculus) [TaxId:10090] [186847] (10 PDB entries)
  8. 2114481Domain d3zfca1: 3zfc A:5-344 [196695]
    Other proteins in same PDB: d3zfca2
    automated match to d4a14a_
    complexed with anp, mg

Details for d3zfca1

PDB Entry: 3zfc (more details), 1.8 Å

PDB Description: Crystal Structure of the Kif4 Motor Domain Complexed With Mg-AMPPNP
PDB Compounds: (A:) chromosome-associated kinesin kif4

SCOPe Domain Sequences for d3zfca1:

Sequence, based on SEQRES records: (download)

>d3zfca1 c.37.1.0 (A:5-344) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vkgipvrvalrcrplvskeikegcqtclsfvpgepqvvvgndksftydfvfdpsteqeev
fntavaplikgvfkgynatvlaygqtgsgktysmggaytaeqehdsaigviprviqllfk
einkksdfeftlkvsyleiyneeildllcssrekatqiniredpkegikivgltektvlv
asdtvscleqgnnsrtvastamnsqssrshaiftisieqrkkndknssfrsklhlvdlag
serqkktkaegdrlregininrgllclgnvisalgddkkgnfvpyrdskltrllqdslgg
nshtlmiacvspadsnleetlntlryadrarkiknkpiin

Sequence, based on observed residues (ATOM records): (download)

>d3zfca1 c.37.1.0 (A:5-344) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vkgipvrvalrcrplvskeikegcqtclsfvpgepqvvvgndksftydfvfdpsteqeev
fntavaplikgvfkgynatvlaygqtgsgktysmggaytaeqehdsaigviprviqllfk
einkksdfeftlkvsyleiyneeildllcsqiniredpkegikivgltektvlvasdtvs
cleqgnnsrtvastamnsqssrshaiftisieqrkkndknssfrsklhlvdlagserqkk
tkaegdrlregininrgllclgnvisalgddkkgnfvpyrdskltrllqdslggnshtlm
iacvspadsnleetlntlryadrarkiknkpiin

SCOPe Domain Coordinates for d3zfca1:

Click to download the PDB-style file with coordinates for d3zfca1.
(The format of our PDB-style files is described here.)

Timeline for d3zfca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zfca2