Lineage for d3w4yc_ (3w4y C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083284Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1083889Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) (S)
  5. 1083913Family a.24.15.0: automated matches [191449] (1 protein)
    not a true family
  6. 1083914Protein automated matches [190684] (2 species)
    not a true protein
  7. 1083915Species Saccharomyces cerevisiae [TaxId:559292] [194765] (2 PDB entries)
  8. 1083918Domain d3w4yc_: 3w4y C: [196692]
    automated match to d3o55a_
    complexed with fad

Details for d3w4yc_

PDB Entry: 3w4y (more details), 2 Å

PDB Description: Crystal structure of yeast Erv1 core
PDB Compounds: (C:) Mitochondrial FAD-linked sulfhydryl oxidase ERV1

SCOPe Domain Sequences for d3w4yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w4yc_ a.24.15.0 (C:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
gshmpgsrtyrkvdppdveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiyp
cnwcakdfekyirenapqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwd

SCOPe Domain Coordinates for d3w4yc_:

Click to download the PDB-style file with coordinates for d3w4yc_.
(The format of our PDB-style files is described here.)

Timeline for d3w4yc_: