SCOPe 2.02: Domain d3w4yc_: 3w4y C:

Lineage for d3w4yc_ (3w4y C:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.0: automated matches [191449] (1 protein)
   not a true family

6. Protein automated matches [190684] (2 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:559292] [194765] (2 PDB entries)

8. Domain d3w4yc_: 3w4y C: [196692]
   automated match to d3o55a_
   complexed with fad

Details for d3w4yc_

PDB Entry: 3w4y, 2 Å

PDB Description: Crystal structure of yeast Erv1 core

PDB Compounds: (C:) Mitochondrial FAD-linked sulfhydryl oxidase ERV1

SCOPe Domain Sequences for d3w4yc_:

Sequence; same for both SEQRES and ATOM records:

>d3w4yc_ a.24.15.0 (C:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
gshmpgsrtyrkvdppdveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiyp
cnwcakdfekyirenapqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwd

Timeline for d3w4yc_:

• d3w4yc_ is new in SCOPe 2.02-stable
  
• d3w4yc_ appears in SCOPe 2.03
  
• d3w4yc_ appears in the current release, SCOPe 2.08, called d3w4yc1