SCOPe 2.08: Domain d3w4yc1: 3w4y C:73-188

Lineage for d3w4yc1 (3w4y C:73-188)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.0: automated matches [191449] (1 protein)
   not a true family

6. Protein automated matches [190684] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [194765] (3 PDB entries)

8. Domain d3w4yc1: 3w4y C:73-188 [196692]
   Other proteins in same PDB: d3w4yb2, d3w4yc2
   automated match to d3o55a_
   complexed with fad

Details for d3w4yc1

PDB Entry: 3w4y, 2 Å

PDB Description: Crystal structure of yeast Erv1 core

PDB Compounds: (C:) Mitochondrial FAD-linked sulfhydryl oxidase ERV1

SCOPe Domain Sequences for d3w4yc1:

Sequence; same for both SEQRES and ATOM records:

>d3w4yc1 a.24.15.0 (C:73-188) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mpgsrtyrkvdppdveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiypcnw
cakdfekyirenapqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwd

Timeline for d3w4yc1:

• d3w4yc1 first appeared in SCOPe 2.02, called d3w4yc_
  
• d3w4yc1 appears in SCOPe 2.07