Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) |
Family a.24.15.0: automated matches [191449] (1 protein) not a true family |
Protein automated matches [190684] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [194765] (3 PDB entries) |
Domain d3w4yc1: 3w4y C:73-188 [196692] Other proteins in same PDB: d3w4yb2, d3w4yc2 automated match to d3o55a_ complexed with fad |
PDB Entry: 3w4y (more details), 2 Å
SCOPe Domain Sequences for d3w4yc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w4yc1 a.24.15.0 (C:73-188) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mpgsrtyrkvdppdveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiypcnw cakdfekyirenapqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwd
Timeline for d3w4yc1: