Lineage for d3w4ya_ (3w4y A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700461Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) (S)
  5. 2700493Family a.24.15.0: automated matches [191449] (1 protein)
    not a true family
  6. 2700494Protein automated matches [190684] (3 species)
    not a true protein
  7. 2700498Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [194765] (3 PDB entries)
  8. 2700500Domain d3w4ya_: 3w4y A: [196691]
    Other proteins in same PDB: d3w4yb2, d3w4yc2
    automated match to d3o55a_
    complexed with fad

Details for d3w4ya_

PDB Entry: 3w4y (more details), 2 Å

PDB Description: Crystal structure of yeast Erv1 core
PDB Compounds: (A:) Mitochondrial FAD-linked sulfhydryl oxidase ERV1

SCOPe Domain Sequences for d3w4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w4ya_ a.24.15.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
srtyrkvdppdveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiypcnwcak
dfekyirenapqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwd

SCOPe Domain Coordinates for d3w4ya_:

Click to download the PDB-style file with coordinates for d3w4ya_.
(The format of our PDB-style files is described here.)

Timeline for d3w4ya_: