SCOPe 2.06: Domain d19hca_: 19hc A:

Lineage for d19hca_ (19hc A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Nine-heme cytochrome c [48705] (2 species)
   tandem repeat of two cytochrome c3-like domains with additional heme-binding site in the domain interface

7. Species Desulfovibrio desulfuricans, ATCC 27774 [TaxId:876] [48706] (3 PDB entries)

8. Domain d19hca_: 19hc A: [19668]
   complexed with act, hem

Details for d19hca_

PDB Entry: 19hc, 1.8 Å

PDB Description: nine-haem cytochrome c from desulfovibrio desulfuricans atcc 27774

PDB Compounds: (A:) protein (nine-haem cytochrome c)

SCOPe Domain Sequences for d19hca_:

Sequence; same for both SEQRES and ATOM records:

>d19hca_ a.138.1.1 (A:) Nine-heme cytochrome c {Desulfovibrio desulfuricans, ATCC 27774 [TaxId: 876]}
aaleptdsgapsaivmfpvgekpnpkgaamkpvvfnhlihekkiadcetchhtgdpvscs
tchtvegkaegdyitldramhatdiaarakgntptscvschqsetkerrecagchaittp
kddeawcatchditpsmtpsemqkgiagtllpgdnealaaetvlaeatvapvspmlapyk
vvidaladkyepsdfthrrhltslmesikddklaqafhdkpeilcatchhrsplsltppk
cgschtkeidaadpgrpnlmaayhlecmgchkgmavarprdtdcttchkaaa

Timeline for d19hca_:

• d19hca_ first appeared (with stable ids) in SCOP 1.55
  
• d19hca_ appears in SCOPe 2.05
  
• d19hca_ appears in SCOPe 2.07
  
• d19hca_ appears in the current release, SCOPe 2.08