Lineage for d19hca_ (19hc A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) 
Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins) 
Protein Nine-haem cytochrome c [48705] (1 species) Species Desulfovibrio desulfuricans, ATCC 27774 [TaxId:876] [48706] (1 PDB entry) 
Domain d19hca_: 19hc A: [19668]
Details for d19hca_
PDB Entry: 19hc (more details), 1.8 Å
PDB Description: nine-haem cytochrome c from desulfovibrio desulfuricans atcc 27774
SCOP Domain Sequences for d19hca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d19hca_ a.138.1.1 (A:) Nine-haem cytochrome c {Desulfovibrio desulfuricans, ATCC 27774}
aaleptdsgapsaivmfpvgekpnpkgaamkpvvfnhlihekkiadcetchhtgdpvscs
tchtvegkaegdyitldramhatdiaarakgntptscvschqsetkerrecagchaittp
kddeawcatchditpsmtpsemqkgiagtllpgdnealaaetvlaeatvapvspmlapyk
vvidaladkyepsdfthrrhltslmesikddklaqafhdkpeilcatchhrsplsltppk
cgschtkeidaadpgrpnlmaayhlecmgchkgmavarprdtdcttchkaaa
SCOP Domain Coordinates for d19hca_:
Click to download the PDB-style file with coordinates for d19hca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d19hca_:
- d19hca_ appears in SCOP 1.57
- d19hca_ appears in the current release, SCOPe 2.08
View in 3D
