Lineage for d19hca_ (19hc A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734167Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2734246Protein Nine-heme cytochrome c [48705] (2 species)
    tandem repeat of two cytochrome c3-like domains with additional heme-binding site in the domain interface
  7. 2734247Species Desulfovibrio desulfuricans, ATCC 27774 [TaxId:876] [48706] (3 PDB entries)
  8. 2734250Domain d19hca_: 19hc A: [19668]
    complexed with act, hem
    multiple common domains: applies to families that are inconsistently divided into domains

Details for d19hca_

PDB Entry: 19hc (more details), 1.8 Å

PDB Description: nine-haem cytochrome c from desulfovibrio desulfuricans atcc 27774
PDB Compounds: (A:) protein (nine-haem cytochrome c)

SCOPe Domain Sequences for d19hca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d19hca_ a.138.1.1 (A:) Nine-heme cytochrome c {Desulfovibrio desulfuricans, ATCC 27774 [TaxId: 876]}
aaleptdsgapsaivmfpvgekpnpkgaamkpvvfnhlihekkiadcetchhtgdpvscs
tchtvegkaegdyitldramhatdiaarakgntptscvschqsetkerrecagchaittp
kddeawcatchditpsmtpsemqkgiagtllpgdnealaaetvlaeatvapvspmlapyk
vvidaladkyepsdfthrrhltslmesikddklaqafhdkpeilcatchhrsplsltppk
cgschtkeidaadpgrpnlmaayhlecmgchkgmavarprdtdcttchkaaa

SCOPe Domain Coordinates for d19hca_:

Click to download the PDB-style file with coordinates for d19hca_.
(The format of our PDB-style files is described here.)

Timeline for d19hca_: