![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
![]() | Protein Nine-heme cytochrome c [48705] (2 species) tandem repeat of two cytochrome c3-like domains with additional heme-binding site in the domain interface |
![]() | Species Desulfovibrio desulfuricans, ATCC 27774 [TaxId:876] [48706] (3 PDB entries) |
![]() | Domain d19hca_: 19hc A: [19668] complexed with act, hem multiple common domains: applies to families that are inconsistently divided into domains |
PDB Entry: 19hc (more details), 1.8 Å
SCOPe Domain Sequences for d19hca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d19hca_ a.138.1.1 (A:) Nine-heme cytochrome c {Desulfovibrio desulfuricans, ATCC 27774 [TaxId: 876]} aaleptdsgapsaivmfpvgekpnpkgaamkpvvfnhlihekkiadcetchhtgdpvscs tchtvegkaegdyitldramhatdiaarakgntptscvschqsetkerrecagchaittp kddeawcatchditpsmtpsemqkgiagtllpgdnealaaetvlaeatvapvspmlapyk vvidaladkyepsdfthrrhltslmesikddklaqafhdkpeilcatchhrsplsltppk cgschtkeidaadpgrpnlmaayhlecmgchkgmavarprdtdcttchkaaa
Timeline for d19hca_: