Lineage for d4hepg_ (4hep G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743778Domain d4hepg_: 4hep G: [196678]
    Other proteins in same PDB: d4hepa1, d4hepa2
    automated match to d1ol0a_
    complexed with so4

Details for d4hepg_

PDB Entry: 4hep (more details), 1.75 Å

PDB Description: complex of lactococcal phage tp901-1 with a llama vhh (vhh17) binder (nanobody)
PDB Compounds: (G:) vHH17 domain

SCOPe Domain Sequences for d4hepg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hepg_ b.1.1.1 (G:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqpggslrlsceasgfsfddyaigwfrqapgkeregvsyismsdgrtyva
dsvtgrftissdnakntvylqmnslkledtavyycaagrfvtfgsawsfvgggpygidyw
gkgtlvtvss

SCOPe Domain Coordinates for d4hepg_:

Click to download the PDB-style file with coordinates for d4hepg_.
(The format of our PDB-style files is described here.)

Timeline for d4hepg_: