Lineage for d4hemf_ (4hem F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (149 PDB entries)
  8. 2347714Domain d4hemf_: 4hem F: [196676]
    Other proteins in same PDB: d4hema1, d4hemb1, d4hemc1
    automated match to d3qxta_

Details for d4hemf_

PDB Entry: 4hem (more details), 1.65 Å

PDB Description: llama vhh-02 binder of orf49 (rbp) from lactococcal phage tp901-1
PDB Compounds: (F:) Anti-baseplate TP901-1 Llama vHH 02

SCOPe Domain Sequences for d4hemf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hemf_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasestfsnyamgwfrqapgperefvatisqtgshtyy
rnsvkgrftisrdnakntvylqmnnmkpedtavyycaagdnyyytrtyeydywgqgtqvt
vs

SCOPe Domain Coordinates for d4hemf_:

Click to download the PDB-style file with coordinates for d4hemf_.
(The format of our PDB-style files is described here.)

Timeline for d4hemf_: