Lineage for d4el8a_ (4el8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004171Protein automated matches [196672] (2 species)
    not a true protein
  7. 2004172Species Caldicellulosiruptor bescii [TaxId:521460] [196673] (5 PDB entries)
  8. 2004177Domain d4el8a_: 4el8 A: [196674]
    automated match to d1g9ga_
    complexed with ca, edo, so4

Details for d4el8a_

PDB Entry: 4el8 (more details), 2.45 Å

PDB Description: The unliganded structure of C.bescii CelA GH48 module
PDB Compounds: (A:) Glycoside hydrolase family 48

SCOPe Domain Sequences for d4el8a_:

Sequence, based on SEQRES records: (download)

>d4el8a_ a.102.1.2 (A:) automated matches {Caldicellulosiruptor bescii [TaxId: 521460]}
geygqrfmwlwnkihdpangyfnqdgipyhsvetliceapdyghlttseafsyyvwleav
ygkltgdwskfktawdtlekymipsaedqpmrsydpnkpatyagewetpdkypsplefnv
pvgkdplhnelvstygstlmygmhwlmdvdnwygygkrgdgvsrasfintfqrgpeesvw
etvphpsweefkwggpngfldlfikdqnyskqwrytdapdadaraiqatywakvwakeqg
kfneissyvakaakmgdylryamfdkyfkplgcqdknaaggtgydsahyllswyyawgga
ldgawswkigsshvhfgyqnpmaawalandsdmkpkspngasdwakslkrqiefyrwlqs
aegaiaggatnswngryekypagtatfygmayepnpvyhdpgsntwfgfqawsmqrvaey
yyvtgdkdagallekwvswvksvvklnsdgtfaipstldwsgqpdtwngaytgnsnlhvk
vvdygtdlgitaslanallyysagtkkygvfdegaknlakelldrmwklyrdekglsape
kradykrffeqevyipagwigkmpngdviksgvkfidirskykqdpdwpkleaayksgqa
pefryhrfwaqcdiaianatyeilf

Sequence, based on observed residues (ATOM records): (download)

>d4el8a_ a.102.1.2 (A:) automated matches {Caldicellulosiruptor bescii [TaxId: 521460]}
geygqrfmwlwnkihdpangyfnqdgipyhsvetliceapdyghlttseafsyyvwleav
ygkltgdwskfktawdtlekymipsaedqpmsydpnkpatyagewetpdkypsplefnvp
vgkdplhnelvstygstlmygmhwlmdvdnwygygkrgdgvsrasfintfqrgpeesvwe
tvphpsweefkwggpngfldlfikdqnyskqwrytdapdadaraiqatywakvwakeqgk
fneissyvakaakmgdylryamfdkyfkplgcqdknaaggtgydsahyllswyyawggal
wswkigsshvhfgyqnpmaawalandsdmkpkspngasdwakslkrqiefyrwlqsaega
iaggatnswngryekypagtatfygmayepnpvyhdpgsntwfgfqawsmqrvaeyyyvt
gdkdagallekwvswvksvvklnsdgtfaipstldwsgqpdtwngaytgnsnlhvkvvdy
gtdlgitaslanallyysagtkkygvfdegaknlakelldrmwklyrdekglsapekrad
ykrffeqevyipagwigkmpngdviksgvkfidirskykqdpdwpkleaayksgqapefr
yhrfwaqcdiaianatyeilf

SCOPe Domain Coordinates for d4el8a_:

Click to download the PDB-style file with coordinates for d4el8a_.
(The format of our PDB-style files is described here.)

Timeline for d4el8a_: